perk in a sentence

Use ‘perk’ in a sentence | ‘perk’ example sentences

1- There’s the perk of letting you join communities for paying members.

2- They also did away with minimum spending thresholds to qualify for the perk.

3- Another perk: the space has also been featured in a few Sons of Anarchy episodes.

4- He also, it seems, took advantage of the classic tech-job perk: the free branded hoodie.

5- 175690Could we imagine robots as a way to perk us up to the point where we’d be able to reach out?

6- This was provided as a free and a much valued perk with which to attract people of the right calibre.

7- The Diamond Shamrock Building rises behind Chester Commons (now perk Park) in 1973.

8- Richie and Eddie soon perk up, though, when she asks if she may breast-feed young Master Bates in their kitchen..

9- “Conserved intermolecular salt bridge required for activation of protein kinases PKR, GCN2, and perk“.

10- No. 14, season 5. * Gary ( Michael Rapaport )-a cop who accidentally leaves his badge in Central perk.

11- “Dearborn seniors may lose Fla. perk; City considers selling beach-view apartment tower to fill budget hole”.

More Sentences:
Related Words:
peritonitisperiwinkleperiwinklesperjureperjuredperjurerperjuryperkperkingperksperkypermpermafrostpermanencepermanency

—————————
This site is designed to teach you English words in context with collocations with the help of example sentences.
You can easily memorize the word and the meaning of “perk”
and This is a fast way of learning the meaning of “perk” with example sentences.
Always focus on the learning on sentences with “perk“
We believe you will easily learn to write and use the word perk in a sentence.
You can practice spelling and usage of the word by getting 10 examples of sentences with “perk”.
20 examples of simple sentences of “perk“
We tried to find and publish the the words with Simple Sentences of “perk“
Compound Sentences with “perk”
Complex Sentences with “perk”
Compound-Complex Sentences with perk in a sentence.



Learn and study English with lots of free online and interactive exercises, games, tests, quiz and activities. All these English teaching activities are designed according to the needs of ELT Esl learning and teaching.